PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G207900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 279aa    MW: 28446.7 Da    PI: 8.4871
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G207900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.23.5e-081772192163
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         R RKk+++ e ++ v +L+ eN+aL++e++ l+  + +l +e+
  Sevir.4G207900.1.p 177 RPRKKMRLPEIQQLVRSLSVENDALREEMKALQRACTALSKEN 219
                         89*************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.8E-5177215No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MTAVDAESCA VVAAAADIIC SLRGADLAGW TPPWRKDAAP ALPSACDGGG GGQEVGGDAR  60
GMAWPAVARG KRSRSRRAGT PSASGSASAG AAAKEDEEEE KKKKKGRRGA RGSPASPLDY  120
SGGSGSGAST SGGEDGAFCS QPAPASATAA PSIKQVGGLA GRRSILPVPP PRPAGQRPRK  180
KMRLPEIQQL VRSLSVENDA LREEMKALQR ACTALSKENG KLETRLDHSS KRNGMISAED  240
KAKPKPGSQE AEAEAEAEAE QDAGNGFVLP DLNLPADD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17075KRSRSR
2176182RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542929e-74BT054292.1 Zea mays full-length cDNA clone ZM_BFb0217J09 mRNA, complete cds.
GenBankKJ7283269e-74KJ728326.1 Zea mays clone pUT6607 bZIP transcription factor (bZIP93) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965736.11e-131PREDICTED: uncharacterized protein LOC101785507 isoform X1
TrEMBLA0A060D2S43e-90A0A060D2S4_MAIZE; BZIP transcription factor (Fragment)
STRINGGRMZM2G050912_P013e-89(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951